Protein coding transcript 497

• Transcript: Ll_transcript_357359
• CDS coordinates: 2-355 (+)
• Peptide sequence: KAPRIRTKNLISIIFCEVVAIYGVIMSIVFSAKLASVGSDAARSGSNYYTGFALFWSGLLVGACNLVCGVSVGINGSSAALADAADPSLFVKILVIEIFSSVLGLFGLIIGLLLSGPA
• ORF Type: internal

Annotations of Ll_transcript_357359

• Blastp: Probable V-type proton ATPase 20 kDa proteolipid subunit from Schizosaccharomyces with 71.19% of identity
• Blastx: Probable V-type proton ATPase 20 kDa proteolipid subunit from Schizosaccharomyces with 70.59% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC2C4.13)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016196972.1)
• Pfam: ATP synthase subunit C (PF00137.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;