Protein coding transcript 49709

• Transcript: Ll_transcript_327510
• CDS coordinates: 1224-2174 (+)
• Peptide sequence: MSVAASLVQGVYILERDRQEKREGPNVLAPPWWTFFNFQLLRPLIDDVDSSIFGAIYEFKPPPSQNNDTLDRSPRYVIAFRGTLTKSDSVSRDIALDIHLIRQGLHQTSRSDIAIRAVRNMVATVGDSNVWLAGHSLGSAMAMLTGKTLAKSGNFIESFLFNPPFVSAPIERIKDEKVKHGIRFAGSVITAGLTIAMHAKQPKDLSVDPFAALAVWVPCLFVNPCDHICSEYIGYFEHRRKMDEIGAGVIERLATQNSLGGLLMSAFGKESEPLHLIPSAYLTVNIGPTHDFKDAHGIHQWWKPHLHLEHKLYKYK*
• ORF Type: complete

Annotations of Ll_transcript_327510

• Blastp: GDSL esterase/lipase At4g10955 from Arabidopsis with 60.92% of identity
• Blastx: GDSL esterase/lipase At4g10955 from Arabidopsis with 61.64% of identity
• Eggnog: GDSL esterase lipase(ENOG410YP6W)
• Kegg: Link to kegg annotations (AT4G10955)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446506.1)
• Pfam: Lipase (class 3) (PF01764.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;