Transcript | Ll_transcript_326648 |
---|---|
CDS coordinates | 336-1001 (+) |
Peptide sequence | MFGSNRSPLKAAKPSSGGPVKSVPNPFDSDDETKDNKDYNSSRKISSERALVALDTISNPFDDVNADTNPFGDVDADTNSSSSSYALRSADRNMYKNDFCYAGGLENKSVQELEGYAVYKAEETTKSVNNCLKIAETIREDATQTLVTLHQQGEQITRSHYVAADIDRDLSRGEKLLGTLGGSSVKLGDRIRHVPLQAPLSLEMIRSEVRAAIWSRERSWD* |
ORF Type | complete |
Blastp | SNAP25 homologous protein SNAP33 from Arabidopsis with 50.25% of identity |
---|---|
Blastx | SNAP25 homologous protein SNAP29 from Arabidopsis with 47.58% of identity |
Eggnog | Synaptosomal-associated protein(ENOG410Y3Y0) |
Kegg | Link to kegg annotations (AT5G61210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436093.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer