Protein coding transcript 49751

• Transcript: Ll_transcript_326654
• CDS coordinates: 336-1001 (+)
• Peptide sequence: MFGSNRSPLKAAKPSSGGPVKSVPNPFDSDDETKDNKDYNSSRKISSERALVALDTISNPFDDVNADTNPFGDVDADTNSSSSSYALRSADRNMYKNDFCYAGGLENKSVQELEGYAVYKAEETTKSVNNCLKIAETIREDATQTLVTLHQQGEQITRSHYVAADIDRDLSRGEKLLGTLGGSSVKLGDRIRHVPLQAPLSLEMIRSEVRAAIWSRERSWD*
• ORF Type: complete

Annotations of Ll_transcript_326654

• Blastp: SNAP25 homologous protein SNAP33 from Arabidopsis with 50.25% of identity
• Blastx: SNAP25 homologous protein SNAP33 from Arabidopsis with 50.25% of identity
• Eggnog: Synaptosomal-associated protein(ENOG410Y3Y0)
• Kegg: Link to kegg annotations (AT5G61210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436093.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;