Protein coding transcript 49760

• Transcript: Ll_transcript_326653
• CDS coordinates: 100-591 (+)
• Peptide sequence: MGKSVLAASNDAFSPFLHSYAHCSKGRNGITLLLINFSNRNRFILTVRGGETVSSGINEDAKSIRVEKSFFYHLKRAFSWVGRKGSDITFREEYHLTPKDYNLRSQTMMLNGIPLELSNDGEIPTMTPVQSNVHSPISIAPLSIAFIVYPDFDAPACNGHKKR*
• ORF Type: complete

Annotations of Ll_transcript_326653

• Blastp: Heparanase-like protein 1 from Arabidopsis with 50.94% of identity
• Blastx: Heparanase-like protein 1 from Arabidopsis with 50.92% of identity
• Eggnog: Heparanase(ENOG410YDJW)
• Kegg: Link to kegg annotations (AT5G07830)
• CantataDB: Link to cantataDB annotations (CNT0001670)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462483.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;