Protein coding transcript 4977

• Transcript: Ll_transcript_321675
• CDS coordinates: 144-518 (+)
• Peptide sequence: MEEGRVVMSEYTQDGSVDLKGKPILKSKRGGWKACSFLVVYEIFERMAYYGISSNLILYLTKKLHQGTITSSNNVTNWAGTIWLTPIIGAYVADAHLGRYWTFVVASIIYLLVYYAFLSHFNSL*
• ORF Type: complete

Annotations of Ll_transcript_321675

• Blastp: Protein NRT1/ PTR FAMILY 5.3 from Arabidopsis with 71.7% of identity
• Blastx: Protein NRT1/ PTR FAMILY 5.3 from Arabidopsis with 71.7% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT5G46040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449956.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;