Protein coding transcript 49773

• Transcript: Ll_transcript_326646
• CDS coordinates: 585-956 (+)
• Peptide sequence: MGFQFILFLFLASLRVGVTLNQDVAHGSLQVHGTEAKAETGDNFICATIDWWPHDKCDYSHCPWGYSSVVNLDLTHPFLAKAIQGLYVCITQVHMIYKIQLLNSHRKMLQCLFFMNVIIYGME*
• ORF Type: complete

Annotations of Ll_transcript_326646

• Blastp: Heparanase-like protein 1 from Arabidopsis with 59.7% of identity
• Blastx: Heparanase-like protein 1 from Arabidopsis with 60.52% of identity
• Eggnog: Heparanase(ENOG410YDJW)
• Kegg: Link to kegg annotations (AT5G07830)
• CantataDB: Link to cantataDB annotations (CNT0000518)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417534.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;