Protein coding transcript 49785

• Transcript: Ll_transcript_327768
• CDS coordinates: 829-1287 (+)
• Peptide sequence: MFDVASRYLLFPLKRAVADVLLPHLEMVSPEELCHWLILADMYGVIKIREYCLDTIACNFETFADTKEFRAMLLTLPPPSGDSSLRTTVPSVPGSSLNTDQGNLLDDLREKWLEIEAAELDKRDESALQFDHRLEMLLHVAEQENSGAQKQP*
• ORF Type: complete

Annotations of Ll_transcript_327768

• Blastp: BTB/POZ domain-containing protein At2g04740 from Arabidopsis with 75.5% of identity
• Blastx: BTB/POZ domain-containing protein At2g04740 from Arabidopsis with 74.4% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G04740)
• CantataDB: Link to cantataDB annotations (CNT0001043)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447476.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;