| Transcript | Ll_transcript_327781 |
|---|---|
| CDS coordinates | 263-859 (+) |
| Peptide sequence | MDFEAKRFGRGHKELGGAHDLISQYKLWPYYEFFCKRSHPASIAETHYLHNVVGDTKIRKGEGMELDQLCRNASTSEKETCLHPFGLDVLSEAFHMKEMSPTQKGLVTPVPKSEKNRKDKDKDRKGEKHTRHKPHQVKDGSCIENNRICPKYSHPMQLKVQQDKVSSHWRQSYPSREHPQVCGANSPNGHFFHPQGSNL |
| ORF Type | 3prime_partial |
| Blastp | Probable mediator of RNA polymerase II transcription subunit 19b from Arabidopsis with 56.41% of identity |
|---|---|
| Blastx | Probable mediator of RNA polymerase II transcription subunit 19b from Arabidopsis with 56.41% of identity |
| Eggnog | NA(ENOG410YJQ4) |
| Kegg | Link to kegg annotations (AT5G19480) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437383.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer