Protein coding transcript 49790

• Transcript: Ll_transcript_327786
• CDS coordinates: 263-853 (+)
• Peptide sequence: MDFEAKRFGRGHKELGGAHDLISQYKLWPYYEFFCKRSHPASIAETHYLHNVVGDTKIRKGEGMELDQLCRNASTSEKETCLHPFGLDVLSEAFHMKEMSPTQKGLVTPVPKSEKNRKDKDKDRKGEKHTRHKPHQVKDGSCIENNRICPKYSHPMQLKVQQDKVSSHWRQSYPSREHPQKRKAETSNYRSEAIKY*
• ORF Type: complete

Annotations of Ll_transcript_327786

• Blastp: Probable mediator of RNA polymerase II transcription subunit 19b from Arabidopsis with 56.41% of identity
• Blastx: Probable mediator of RNA polymerase II transcription subunit 19b from Arabidopsis with 56.41% of identity
• Eggnog: NA(ENOG410YJQ4)
• Kegg: Link to kegg annotations (AT5G19480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437383.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;