Protein coding transcript 49822

• Transcript: Ll_transcript_327055
• CDS coordinates: 205-834 (+)
• Peptide sequence: MCRQNSHRSGDEEIEADESLLIYCKPVELYNILYRRALHNPSFLSRCLHYKIKARRKRRLRAGVVVFNYRDCYNMLRKTEVTEDFSCPFCLVQCASFKGLRFHLCSSHDLFNFEFWVTEDYQAVNVSVKIDISRSENVADGENPKSETFFFCSRPRKRKRKDFTQNEKRASVKFLELDSPEGRHNGFVEKNDGNKIVVVTFVIIYSYFF*
• ORF Type: complete

Annotations of Ll_transcript_327055

• Blastp: Polycomb group protein VERNALIZATION 2 from Arabidopsis with 56.65% of identity
• Blastx: Polycomb group protein VERNALIZATION 2 from Arabidopsis with 55.72% of identity
• Eggnog: suppressor of zeste 12 homolog (Drosophila)(ENOG410YJ29)
• Kegg: Link to kegg annotations (AT4G16845)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422145.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;