Transcript | Ll_transcript_327056 |
---|---|
CDS coordinates | 205-1083 (+) |
Peptide sequence | MCRQNSHRSGDEEIEADESLLIYCKPVELYNILYRRALHNPSFLSRCLHYKIKARRKRRLRAGVVVFNYRDCYNMLRKTEVTEDFSCPFCLVQCASFKGLRFHLCSSHDLFNFEFWVTEDYQAVNVSVKIDISRSENVADGENPKSETFFFCSRPRKRKRKDFTQNEKRASVKFLELDSPEGRHNGFVEKNDDILSYKGENISGTSSIQKNLQNGGQGGGKFDPDHPATMDYLEHVASSFNIPGVPIAMPLSSGDPECSKSVHRSDPVVPAKTKKLNMDRSDSKKYDFFFVL* |
ORF Type | complete |
Blastp | Polycomb group protein VERNALIZATION 2 from Arabidopsis with 44.71% of identity |
---|---|
Blastx | Polycomb group protein VERNALIZATION 2 from Arabidopsis with 42.66% of identity |
Eggnog | suppressor of zeste 12 homolog (Drosophila)(ENOG410YJ29) |
Kegg | Link to kegg annotations (AT4G16845) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422144.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer