Protein coding transcript 49823

• Transcript: Ll_transcript_327056
• CDS coordinates: 205-1083 (+)
• Peptide sequence: MCRQNSHRSGDEEIEADESLLIYCKPVELYNILYRRALHNPSFLSRCLHYKIKARRKRRLRAGVVVFNYRDCYNMLRKTEVTEDFSCPFCLVQCASFKGLRFHLCSSHDLFNFEFWVTEDYQAVNVSVKIDISRSENVADGENPKSETFFFCSRPRKRKRKDFTQNEKRASVKFLELDSPEGRHNGFVEKNDDILSYKGENISGTSSIQKNLQNGGQGGGKFDPDHPATMDYLEHVASSFNIPGVPIAMPLSSGDPECSKSVHRSDPVVPAKTKKLNMDRSDSKKYDFFFVL*
• ORF Type: complete

Annotations of Ll_transcript_327056

• Blastp: Polycomb group protein VERNALIZATION 2 from Arabidopsis with 44.71% of identity
• Blastx: Polycomb group protein VERNALIZATION 2 from Arabidopsis with 42.66% of identity
• Eggnog: suppressor of zeste 12 homolog (Drosophila)(ENOG410YJ29)
• Kegg: Link to kegg annotations (AT4G16845)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422144.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;