Protein coding transcript 49825

• Transcript: Ll_transcript_328424
• CDS coordinates: 3-317 (+)
• Peptide sequence: VTDFCSFYTLPSTILGNPNYSTLKAAYSFYNVSTKTPLLQLMNDALIVAKQRDYDVFNALDVMENDSFLKELKFGPGDGKLHYYLYNYRIRQALKPSELGLVLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_328424

• Blastp: Glycylpeptide N-tetradecanoyltransferase 1 from Arabidopsis with 83.65% of identity
• Blastx: Glycylpeptide N-tetradecanoyltransferase 1 from Arabidopsis with 83.65% of identity
• Eggnog: Adds a myristoyl group to the N-terminal glycine residue of certain cellular proteins (By similarity)(COG5092)
• Kegg: Link to kegg annotations (AT5G57020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440605.1)
• Pfam: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain (PF02799.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;