| Transcript | Ll_transcript_326546 |
|---|---|
| CDS coordinates | 659-1210 (+) |
| Peptide sequence | MRFICLYRVEKFRSILQDWEITAASEKLAECQETILNLGKQLKALTAPKEASFFDPVIARQSNTDNMAITTTTTATTNVDTSILPLKVVKVKNRSLLDQMLADDDTKAKVSKAIDCNSTATTIPTIIQPLEKILTLNGVKGQDDDGDTVNSLAILPAKKTRSASLWKKILRRKKSSKKNSPSL* |
| ORF Type | complete |
| Blastp | Filament-like plant protein 7 from Arabidopsis with 38.33% of identity |
|---|---|
| Blastx | Filament-like plant protein 7 from Arabidopsis with 36.25% of identity |
| Eggnog | filament-like plant protein(ENOG410YBNS) |
| Kegg | Link to kegg annotations (AT2G23360) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429771.1) |
| Pfam | Filament-like plant protein, long coiled-coil (PF05911.10) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer