| Transcript | Ll_transcript_357356 |
|---|---|
| CDS coordinates | 162-665 (+) |
| Peptide sequence | MSSNDAQLFNWHHDGDTLNDESLEIRGRKFFFLLVLFVIVLFTMVLFLYVRWICRPQAFSSFQRRHALQMPPSSQGLADETIKKLPILLHQTKSEQDSACECCICLSAFRDGEKVKVLPGCEHWFHCECVDKWLMNHSNCPLCRASLNFVDSSFPTILIQEPPIRHH* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | RING-H2 finger protein ATL72 from Arabidopsis with 46.67% of identity |
| Eggnog | zinc ion binding(ENOG41121N2) |
| Kegg | Link to kegg annotations (AT3G10910) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455818.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer