Protein coding transcript 49910

• Transcript: Ll_transcript_326586
• CDS coordinates: 219-1121 (+)
• Peptide sequence: MFEGLVHQLLLGYLGRYFKDIQKEQLKIRLEEVLLENVELILEAFDYLQLPFALTKGRVGRLSIKIPWKKPWDPIIIILEDVFVSASQRGDQEWSADAVEKREFAGKKAKLAAAELGKLSRRVCGSNAGQSFISHVTAKILDSIQVDIRNFHILYSDVQNDLGHIMFGLKFSNLTMKQNPIGSSNGRMRVGQEHKIVEIKGLEFYFSMFRGSMELVTMNSVGNYSAGNIGSEGKHNNSILSPCDATIIISANRSQKLDDNTPQYSITAELTGLVISFDEAQLQQMLLVWDYVCTCRLREK*
• ORF Type: complete

Annotations of Ll_transcript_326586

• Blastp: Vacuolar protein sorting-associated protein 13 from Sophophora with 27.91% of identity
• Blastx: Vacuolar protein sorting-associated protein 13 from Sophophora with 26.91% of identity
• Eggnog: Vacuolar Protein(COG5043)
• Kegg: Link to kegg annotations (Dmel_CG2093)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412966.1)
• Pfam: N-terminal region of Chorein or VPS13 (PF12624.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;