Protein coding transcript 49996

• Transcript: Ll_transcript_326942
• CDS coordinates: 1067-1585 (+)
• Peptide sequence: MTNAGSKITDSSLRKKLAKELIRNWPSELLNIVDSTPDDTVIRTPLVDRWLWPTITPPASAGSVVLVGDAWHPMTPNLGQGACCALEDAVVLAKKLAGAIKSEDPSVEEALRSYGTERWSRVFPLSIRANLVGSLLQWENPLVCSVRNNIVIPKVVRLGPLLEHTNFTCESL*
• ORF Type: complete

Annotations of Ll_transcript_326942

• Blastp: Monooxygenase 2 from Arabidopsis with 31.07% of identity
• Blastx: Monooxygenase 3 from Arabidopsis with 42.42% of identity
• Eggnog: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen(COG0654)
• Kegg: Link to kegg annotations (AT4G38540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445032.1)
• Pfam: Squalene epoxidase (PF08491.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;