Protein coding transcript 5

• Transcript: Ll_transcript_534367
• CDS coordinates: 2-334 (+)
• Peptide sequence: VHRLNQQILSAKDLKSKLETSSTLLLDLKAELSAYMESKLKREDDEEGNSNGDLKIPEKKTHNDIQTAVASAKKELEEVKLNIEKATYEVSFLKVAATSLKSELEQEKSTL
• ORF Type: internal

Annotations of Ll_transcript_534367

• Blastp: Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1 from Arabidopsis with 64.86% of identity
• Blastx: Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1 from Arabidopsis with 64.86% of identity
• Eggnog: Pfam:DUF827(ENOG410YG1U)
• Kegg: Link to kegg annotations (AT2G26570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414339.1)
• Pfam: Weak chloroplast movement under blue light (PF05701.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;