Protein coding transcript 50001

• Transcript: Ll_transcript_326926
• CDS coordinates: 297-1022 (+)
• Peptide sequence: MEPHEVENNSMVGNISMDEDIKNTIKNESNIVADEIKHDKDENEVSSEVSRISLDGAQVGSLKKKLLVLDINGVLADTVFPPPSDLKGGAMIMKAAIFKRPFCLEFLKFCFEKFEVAIWSSGKKECVEQTIDYLMGDMKQKLLFYWDYSHCTKTALGINLEENKQKHLMFKDLSKIWENYDPNLPWEKGYYNESNTLLLDDSPYKAWLNPVNKPTFNFFLSFVCFLSWHDISVLFANFLIF*
• ORF Type: complete

Annotations of Ll_transcript_326926

• Blastp: Uncharacterized FCP1 homology domain-containing protein C1271.03c from Schizosaccharomyces with 24.22% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC1271.03c)
• CantataDB: Link to cantataDB annotations (CNT0001423)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442401.1)
• Pfam: NLI interacting factor-like phosphatase (PF03031.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;