Protein coding transcript 50023

• Transcript: Ll_transcript_325884
• CDS coordinates: 3-680 (+)
• Peptide sequence: QQQQQQQPPPKKRPHQQQRAPTSYCLRHFAADNSQTHSAHHTINLVHPLAQDNQPNQNERNDEENIDDPKLSELKATSNNALDAAADKPEASTANPHMAMESGPCRGAKRRKSGSVKRFRRQDDDGASKSNPTTVSVEQGQRGVNGDDNNGHMMGDGASAFHIVKIIRPIGYMTSFSSIVDDLSVIFVALRSDGREVTVTNKYLKANNPLLLINYYEENIRYHPM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_325884

• Blastp: Chromo domain protein LHP1 from Lycopersicon with 38.98% of identity
• Blastx: Chromo domain protein LHP1 from Lycopersicon with 37.85% of identity
• Eggnog: chromobox homolog(ENOG4111JKD)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438254.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;