Transcript | Ll_transcript_325886 |
---|---|
CDS coordinates | 3-593 (+) |
Peptide sequence | QQQQQQQPPPKKRPHQQQRAPTSYCLRHFAADNSQTHSAHHTINLVHPLAQDNQPNQNERNDEENIDDPKLSELKATSNNALDAAADKPEASTANPHMAMESGPCRGAKRRKSGSVKRFRRQDDDGASKSNPTTVSVEQGQRGVNGDDNNGHMMGDGASAFHIVKIIRPIGYMTSFSSIVDDLSVIFVALRFVPPY* |
ORF Type | 5prime_partial |
Blastp | Chromo domain protein LHP1 from Lycopersicon with 31.29% of identity |
---|---|
Blastx | Cytoplasmic tRNA 2-thiolation protein 1 from Arabidopsis with 88.89% of identity |
Eggnog | chromobox homolog(ENOG4111JKD) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438254.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer