Transcript | Ll_transcript_325922 |
---|---|
CDS coordinates | 314-1120 (+) |
Peptide sequence | MGYAQLVIGPAGSGKSTYCSSLYEHCVATRRTIHIVNLDPAAENFDYPVAMDIRELISLDDVMEELGLGPNGGLVYCMEHLEDNLDDWFNDELDNYLDDDYLVFDCPGQIELYSHVPVLRNFVEHLKRKNFNVCAVYLLDSQFMTDVTKFISGCMACLSAMVQLELPHVNILSKMDLVTNKKDVEEFLDPEPTFLLSELNQRMAPQFAKLNKSLIELVNNYSMVSFIPLDLRKERSIQYVLAQIDNCIQYGEDADVKVKDFDQDDDDE* |
ORF Type | complete |
Blastp | GPN-loop GTPase 3 from Danio with 54.23% of identity |
---|---|
Blastx | GPN-loop GTPase 3 from Danio with 53.73% of identity |
Eggnog | GPN-loop GTPase 3(ENOG410XPBZ) |
Kegg | Link to kegg annotations (100000326) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449856.1) |
Pfam | Conserved hypothetical ATP binding protein (PF03029.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer