Protein coding transcript 50216

• Transcript: Ll_transcript_328321
• CDS coordinates: 183-662 (+)
• Peptide sequence: MNASNSAAQWKNTSSKGMIKVELKDKYHDKTKASPKSPPRENTKPQEFKLHTQERAVKRAMFNYAVTTKFYLMELQKKREEKLIKMIEEEETRLLRKEMVPRAQLMPYFDKPFSPQRSSKTVPKESCLHMMSSKCWRCTSGNEFYNLNNYGQQALNPIK*
• ORF Type: complete

Annotations of Ll_transcript_328321

• Blastp: Protein TPX2 from Arabidopsis with 46.34% of identity
• Blastx: Protein TPX2 from Arabidopsis with 39.02% of identity
• Eggnog: Cell cycle regulated microtubule associated protein(ENOG410ZTMD)
• Kegg: Link to kegg annotations (AT1G03780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439083.1)
• Pfam: Targeting protein for Xklp2 (TPX2) (PF06886.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;