| Transcript | Ll_transcript_328326 |
|---|---|
| CDS coordinates | 183-536 (+) |
| Peptide sequence | MNASNSAAQWKNTSSKGMIKVELKDKYHDKTKASPKSPPRENTKPQEFKLHTQERAVKRAMFNYAVTTKFYLMELQKKREEKLIKMIEEEETRLLRKEMVPRAQLMPYFDKPFSPQR* |
| ORF Type | complete |
| Blastp | Protein TPX2 from Arabidopsis with 45.57% of identity |
|---|---|
| Blastx | - |
| Eggnog | Cell cycle regulated microtubule associated protein(ENOG410ZTMD) |
| Kegg | Link to kegg annotations (AT1G03780) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439083.1) |
| Pfam | Targeting protein for Xklp2 (TPX2) (PF06886.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer