Protein coding transcript 50220

• Transcript: Ll_transcript_328320
• CDS coordinates: 1-393 (+)
• Peptide sequence: LDTRPFLEATRKKYNEEEAEERTSELCSLWEEYLKDPDWHPFKVIMVEGKETEIIRDDDEKLIGLRSEIGEGAYNAVVTALKEINEYNPSGRYISSQVWNYGQGRVATLQEGVQVLLKQWKTYKRKRGMM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_328320

• Blastp: Factor of DNA methylation 3 from Arabidopsis with 59.52% of identity
• Blastx: Protein INVOLVED IN DE NOVO 2 from Arabidopsis with 54.2% of identity
• Eggnog: XS zinc finger domain(ENOG41106KW)
• Kegg: Link to kegg annotations (AT3G12550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419285.1)
• Pfam: XH domain (PF03469.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;