Transcript | Ll_transcript_328329 |
---|---|
CDS coordinates | 95-712 (+) |
Peptide sequence | MQNTMKNSFLQKASPKLQRRIPEMNDEFEDLVELNKVLMRKQLKSNDELQNARNELIIFIKEIPCGGIIGIKRMGEVHTKPFLEAMKKKYNKDADERASELCSLWEYYMKDPCWHPFKVIMVNGKETEIIRYDDEKLNGLRGEFGVGAYNAVVTALKELNEYNPSGRYVTSQLWNYEQGRLATLQEGVQVLLKQLKVNKRKWGMM* |
ORF Type | complete |
Blastp | Protein INVOLVED IN DE NOVO 2 from Arabidopsis with 47.59% of identity |
---|---|
Blastx | Protein INVOLVED IN DE NOVO 2 from Arabidopsis with 47.59% of identity |
Eggnog | XH XS domain-containing protein(ENOG410YGHF) |
Kegg | Link to kegg annotations (AT3G48670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419285.1) |
Pfam | XH domain (PF03469.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer