Protein coding transcript 50304

• Transcript: Ll_transcript_326625
• CDS coordinates: 3-464 (+)
• Peptide sequence: STGCVMAELFLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLVCRFFQYSPNLRCTALEACIHPFFDELRDPTTRLPNGRPLPPLFNFKPEELSGIPPDVINRLIPEHARKHNLFMALHT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_326625

• Blastp: Thymidine kinase a from Arabidopsis with 81.67% of identity
• Blastx: Shaggy-related protein kinase kappa from Arabidopsis with 92.81% of identity
• Eggnog: THymidine Kinase(COG1435)
• Kegg: Link to kegg annotations (AT3G07800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440412.1)
• Pfam: Thymidine kinase (PF00265.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;