| Transcript | Ll_transcript_327700 |
|---|---|
| CDS coordinates | 110-421 (+) |
| Peptide sequence | MKNGTLDLTQKLFHSNLIPFQRSTLFFHQPFPMAEPAPSNTAPAPHPIQPDIPKKQVPPPPPEKPDPFDCCGSGCVRCVWDVYYDELDQYDKLYKQDNENTES* |
| ORF Type | complete |
| Blastp | UPF0651 protein P31B10.02, mitochondrial from Schizosaccharomyces with 48.78% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPCP31B10.02) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447301.1) |
| Pfam | Oxidoreductase-like protein, N-terminal (PF09791.8) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer