Protein coding transcript 50421

• Transcript: Ll_transcript_328160
• CDS coordinates: 3496-3843 (+)
• Peptide sequence: MHHDCPICCEYLFETTKDILVLPCGHTIHKCCLEEMRKHLQYACPLCSKSIYDMSKVWEKLDLEIAATPMPPPYRNKMVSILCNDCGKYSHNVRFHFVGHKCLHCNSYNTRQTSG*
• ORF Type: complete

Annotations of Ll_transcript_328160

• Blastp: E3 ubiquitin-protein ligase RZFP34 from Arabidopsis with 63.72% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 68.06% of identity
• Eggnog: ring finger and CHY zinc finger(ENOG410XXHF)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457803.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;