Protein coding transcript 50433

• Transcript: Ll_transcript_328145
• CDS coordinates: 1836-2468 (+)
• Peptide sequence: MGEVAVMHSEPLQLECYGMNRMTENDVHTPKSNEPMPEEESNQSTDDINIIDLQGKGYMEHGCQHYRRRCLIRAPCCDEIFDCHHCHNEAKNDTNIDQKHRHNIPRHQVKQVICSLCGTEQEVQQNCINCGVCMGKYFCETCKLFDDDISKQQYHCSDCGICRTGGRENNFHCDKCGCCYSILLKNSHPCVERAMHHDCPICCEYLFETTK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_328145

• Blastp: Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 70.86% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 70.86% of identity
• Eggnog: ring finger and CHY zinc finger(ENOG410XXHF)
• Kegg: Link to kegg annotations (4324695)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457803.1)
• Pfam: CHY zinc finger (PF05495.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;