Protein coding transcript 50448

• Transcript: Ll_transcript_328162
• CDS coordinates: 259-1050 (+)
• Peptide sequence: MNFSLSTSPFRGNFIPLSSPSTSCFEFDLRFKPYLISSNGFRRSQCRRSSFKFVKDSRLSRKRVIVCNVTEPDGNNEEEKDTHKNEEIQALQNSFEQNSPQPIDAEQLNKFSDENKDQNDVQEKDAHKNEEMQALENSFEQNSPQPIDAEQVNKFSDENKDQNDVQSVDSIEVASGSPLPGVKPRQLGEAIKIPKETIDILKNQVFGFDTFFVTSQDPYEVCAYLPSISFSICTKVFSYERLGLFCFLLGWSVVQGKLAREAW*
• ORF Type: complete

Annotations of Ll_transcript_328162

• Blastp: Probable zinc metalloprotease EGY2, chloroplastic from Arabidopsis with 32.94% of identity
• Blastx: Probable zinc metalloprotease EGY2, chloroplastic from Arabidopsis with 78.89% of identity
• Eggnog: Membrane-associated zinc metalloprotease(COG0750)
• Kegg: Link to kegg annotations (AT5G05740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433527.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;