Transcript | Ll_transcript_326468 |
---|---|
CDS coordinates | 1578-1889 (+) |
Peptide sequence | MRPLQTQTLRIIIFHSLPINIQTLLSLSDPFNQTPFLSHTTVSEEILFCPGWWFNHIVQFGRRFVFLTITTTFYIAGFLGHYLIHCARLWCSIESVDNTIPIP* |
ORF Type | complete |
Blastp | Late embryogenesis abundant protein D-34 from Gossypium with 45.8% of identity |
---|---|
Blastx | Late embryogenesis abundant protein D-34 from Gossypium with 47.86% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456889.1) |
Pfam | Seed maturation protein (PF04927.11) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer