Protein coding transcript 50546

• Transcript: Ll_transcript_326762
• CDS coordinates: 2-424 (+)
• Peptide sequence: RKQFFEYLQGEAESGLERLHQCAEKELQVFLDDEDPSREFNDFRTKLAGLTSVTRNYFENLVKALENGLSDVNSNGANSSKATSSKNAAGSSKRVGRGKGTIRASISSRMTDDNLWSCEHCTYANAKSATTCQMCNQQRR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_326762

• Blastp: Probable E3 ubiquitin-protein ligase ARI8 from Arabidopsis with 60.43% of identity
• Blastx: Probable E3 ubiquitin-protein ligase ARI8 from Arabidopsis with 58.27% of identity
• Eggnog: RING finger) protein(ENOG410XP9Y)
• Kegg: Link to kegg annotations (AT1G65430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436567.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;