Protein coding transcript 50593

• Transcript: Ll_transcript_509267
• CDS coordinates: 159-581 (+)
• Peptide sequence: MASSLQKIEGDESVLLRVTHSNLKTFTADIRFSLQLTVEAVKDKLWKKCGTSVNSMHLELYDDARNKLADLSDNSKLLALYSPLDGFRLHVLDLDPSSVTSGGWLEDTSLVEKYKISDEAYNKLEGMFPTPSVLFKLSLF*
• ORF Type: complete

Annotations of Ll_transcript_509267

• Blastp: Tubulin-folding cofactor B from Arabidopsis with 69.92% of identity
• Blastx: Tubulin-folding cofactor B from Arabidopsis with 69.92% of identity
• Eggnog: tubulin folding cofactor B(ENOG410YKGB)
• Kegg: Link to kegg annotations (AT3G10220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428994.1)
• Pfam: Ubiquitin-like domain (PF14560.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;