Protein coding transcript 506

• Transcript: Ll_transcript_394107
• CDS coordinates: 150-1187 (+)
• Peptide sequence: MLMRILSIGSSKPVDSVEEELGSMLLSFCDKHCPFKLTNKPITCSEAVSKYYHILDLMYHMAVSQQEKPDIVTLEIEDVTSSIEAGNYKRSSSENEDEDTMLKKVKDPIIWILGFLKKLKDMQIPRPIKRHIDAIVNISSIDYGSSETSPSKEKAPVVITIPSVCELHSVGIRFEPSQDGIIAIEFDEKKGIFYLPLIKLDVNSEVIMRNLVAHEALTKPNFLIFTKYTELMREIIDSEKDVKILKESNIIKSNSSLGIKEIEQLFNGMSKSIGPTKTKELDGTINKVTKYYHEKRKANLYRNFTEYVYSSWKFFTLLSTFVLLAMTAIQTVCTAYDCSKVLKRT*
• ORF Type: complete

Annotations of Ll_transcript_394107

• Blastp: Putative UPF0481 protein At3g02645 from Arabidopsis with 34.5% of identity
• Blastx: Putative UPF0481 protein At3g02645 from Arabidopsis with 34.5% of identity
• Eggnog: UPF0481 protein(ENOG410YDVR)
• Kegg: Link to kegg annotations (AT3G02645)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436829.1)
• Pfam: Plant protein of unknown function (PF03140.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;