Protein coding transcript 50612

• Transcript: Ll_transcript_509227
• CDS coordinates: 128-1090 (+)
• Peptide sequence: MALILHAASTNKNTHKTLIAAEYNGVQVQLAPNFEMGVSNKTPEFLKLNPLGKVPVLETPDGPVFESNAIARYVARLKGNASLLGSSLIEQAQVDQWIDFSSLEIDSNILKVLLPRVGFAPYLAPVEEVANAALKRALGALNTHLASHTYLVGHTVTLADIITTANLYLGFSKVLVKSVTSEFPHVERYFWTLVNQPNFRKVLGQVQQTEALPPIPSAKKPAAKETKPKAKEQPKKEAKPQPEKPAEVAEEEAPPKPKAKNPLDLLPPSKLILDEWKRLYSNTKTNFREVAIKGIAILLLVVLNFVTSKQGSKFLLWSRR*
• ORF Type: complete

Annotations of Ll_transcript_509227

• Blastp: Elongation factor 1-gamma from Prunus with 69.46% of identity
• Blastx: Elongation factor 1-gamma 2 from Oryza sativa with 68.26% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425292.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;