Protein coding transcript 50615

• Transcript: Ll_transcript_509236
• CDS coordinates: 1356-1724 (+)
• Peptide sequence: MYDPEGYSLWFCDYKYQDENSVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSQPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDISDEAQKERVNQMIEDYEPFEGETLLDAKCFK*
• ORF Type: complete

Annotations of Ll_transcript_509236

• Blastp: Elongation factor 1-gamma 2 from Oryza sativa with 88.52% of identity
• Blastx: Elongation factor 1-gamma 2 from Oryza sativa with 73.17% of identity
• Eggnog: glutathione Stransferase(COG0625)
• Kegg: Link to kegg annotations (4328752)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425292.1)
• Pfam: Elongation factor 1 gamma, conserved domain (PF00647.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;