Protein coding transcript 50616

• Transcript: Ll_transcript_509241
• CDS coordinates: 317-1174 (+)
• Peptide sequence: MGVSNKTPEFLKLNPLGKVPVLETPDGPVFESNAIARYVARLKGNASLLGSSLIEQAQVDQWIDFSSLEIDSNILKVLLPRVGFAPYLAPVEEVANAALKRALGALNTHLASHTYLVGHTVTLADIITTANLYLGFSKVLVKSVTSEFPHVERYFWTLVNQPNFRKVLGQVQQTEALPPIPSAKKPAAKETKPKAKEQPKKEAKPQPEKPAEVAEEEAPPKPKAKNPLDLLPPSKLILDEWKRLYSNTKTNFREVAIKGIAILLLVVLNFVTSKQGSKFLLWSRR*
• ORF Type: complete

Annotations of Ll_transcript_509241

• Blastp: Elongation factor 1-gamma from Prunus with 69.2% of identity
• Blastx: Elongation factor 1-gamma 2 from Oryza sativa with 68.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425292.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;