Protein coding transcript 50621

• Transcript: Ll_transcript_509221
• CDS coordinates: 1-327 (+)
• Peptide sequence: NMNPLGKVPVLETPHAPVFESNAIARYGNLPTLTFPLCIFSSLITNIQYSILPPSCTIQPSHLFAWIFSHSTGSLIIHSFHFFFIFSHSTGSLIIHSFHFFFIFSHSTG
• ORF Type: internal

Annotations of Ll_transcript_509221

• Blastp: Probable elongation factor 1-gamma 2 from Arabidopsis with 84.62% of identity
• Blastx: Elongation factor 1-gamma 1 from Oryza sativa with 84.62% of identity
• Eggnog: glutathione Stransferase(COG0625)
• Kegg: Link to kegg annotations (AT1G57720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020221597.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;