Protein coding transcript 5066

• Transcript: Ll_transcript_444965
• CDS coordinates: 54-530 (+)
• Peptide sequence: MGRQPCCDKVGVKRGPWTIEEDHKLINFIVNNGIHCWRKVPNLAGLVRCGKSCRLRWINYLRPDLKRGGFTEMEENQIIQLHSLLGNRWSKIAAHFRGRTDNEIKNHWNTRIKKRLKHLGLDPMTKKPIEQMEHFDNGEKNKAYPHPNTSKGSEENIDI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_444965

• Blastp: Myb-related protein Pp2 from Physcomitrella with 70.77% of identity
• Blastx: Myb-related protein Pp2 from Physcomitrella with 70.77% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (PHYPADRAFT_100368)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442407.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;