Protein coding transcript 50683

• Transcript: Ll_transcript_508966
• CDS coordinates: 424-1131 (+)
• Peptide sequence: MDPEQIILWGSTLCIIIAVHFSMKLLSEHVLNWKRPKEQKAIVIIILMAPLYAVDSYVGLINFFGSEAFFTFLDSIKECYEALVIAKFLGLMYSYLNISLSKNIVPDEIKGREIHHSFPMTLFQPHTTHLDHHTLKLLKSWTWQFVVLRPVCSIVMIALQYFEVYPTWVSWTLTIILNLSVSLALYSLVVFYHVFSKELAPHKPLAKFLCIKGIVFFCFWQVFSFAFTFTMIDPP*
• ORF Type: complete

Annotations of Ll_transcript_508966

• Blastp: Transmembrane protein 184B from Mus with 34.83% of identity
• Blastx: Protein LAZ1 homolog 1 from Arabidopsis with 31.52% of identity
• Eggnog: transmembrane protein 184B(ENOG410XQ3V)
• Kegg: Link to kegg annotations (223693)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449132.1)
• Pfam: Organic solute transporter Ostalpha (PF03619.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;