| Transcript | Ll_transcript_394090 |
|---|---|
| CDS coordinates | 1-399 (+) |
| Peptide sequence | GKVASFLSRVLSYLIGIMTCKRRNGGRSKHGRGHVQPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITDASTYPAYQLPKLYAKLHYCVSCAIHSKVVRNRSKAERRNRNPPQRNFPRDMRQGGQPIRK* |
| ORF Type | 5prime_partial |
| Blastp | - |
|---|---|
| Blastx | 40S ribosomal protein S26 from Sophophora with 80.18% of identity |
| Eggnog | Ribosomal protein(COG4830) |
| Kegg | Link to kegg annotations (Dmel_CG10305) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417574.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer