| Transcript | Ll_transcript_508225 |
|---|---|
| CDS coordinates | 433-876 (+) |
| Peptide sequence | MHSLKSTTLKSPTDNTEAYSLKELNVCEGSPKASSGNHANNKKHASKEAVLKLSERIEPYFWCFRSINVKFGSTKFVISSGKIMLGCLMLFTYYLFRKKQATLKRIVRKQVVGMKRALVDLWQLAFSYQVNPLAAVQPLSTATRQAR* |
| ORF Type | complete |
| Blastp | Protein APEM9 from Arabidopsis with 40.65% of identity |
|---|---|
| Blastx | Protein APEM9 from Arabidopsis with 40.65% of identity |
| Eggnog | 3-phosphoinositide-dependent protein(ENOG410YZ8D) |
| Kegg | Link to kegg annotations (AT3G10572) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458998.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer