Transcript | Ll_transcript_508244 |
---|---|
CDS coordinates | 3-437 (+) |
Peptide sequence | SIYFPYSEKQKRLAALHGSIEKLLYDPEQTDDYIGSLKDRSKPIIFSMARLDRVKNITGLVESYAKNSKLRELVNLVVVAGYIDVKKSRDREEIAEIEKLHNLIKEYDLNGDFRWIVSQTNRARNGELYRYIADTKGAFVQVLY* |
ORF Type | 5prime_partial |
Blastp | Sucrose synthase 2 from Pisum with 84.72% of identity |
---|---|
Blastx | Sucrose synthase 2 from Pisum with 84.72% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419501.1) |
Pfam | Sucrose synthase (PF00862.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer