Protein coding transcript 50860

• Transcript: Ll_transcript_509390
• CDS coordinates: 1743-2372 (+)
• Peptide sequence: MQVLVVASSTEHQGWKTVMNMVFFTLFQVIAERLSEEEIGGLKELFRMIDTDNSGTITFDELKDGLKRVGSELMESEIKDLMDAADIDNSGTIDYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITLDEIQQACKHFGLDDIHIDDMIKEIDQDNDGQIDYGEFAAMMRKGNGGIGRRTMRKTLNFREALGLVGNGSNQVIDGLI*
• ORF Type: complete

Annotations of Ll_transcript_509390

• Blastp: Calcium-dependent protein kinase SK5 from Soja with 90.58% of identity
• Blastx: Calcium-dependent protein kinase SK5 from Soja with 81.31% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (547825)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458148.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;