Protein coding transcript 50864

• Transcript: Ll_transcript_509395
• CDS coordinates: 1033-1470 (+)
• Peptide sequence: MLYILLSGVPPFWAETEPGIFRQILMGKIDFQSQPWPSISDSAKDLIRKMLDQNPRTRPTAHEVLSHPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAERLSEEEIGGLKELFRMIDTDNSGTITFDELKDGLKRVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_509395

• Blastp: Calcium-dependent protein kinase SK5 from Soja with 93.15% of identity
• Blastx: Calcium-dependent protein kinase SK5 from Soja with 93.33% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (547825)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458148.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;