Protein coding transcript 50873

• Transcript: Ll_transcript_509675
• CDS coordinates: 143-673 (+)
• Peptide sequence: MVKEIFWSTIVLVICSVIILFQKLWLKPQRIRSMLQKQGISGPKPSFPFGNISEMLRIQHQPPESSNDLDKWVYSIFPYFHTWKQHYGSIYMYSTGIKQHLYVEDAELIKDLNLYKSLDLGRPSHFTESLKPMLGTSGILTNNGLKWSFQRNLISPEFFLSKIKVCMIVFIVNNYIF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_509675

• Blastp: Cytochrome P450 714C2 from Oryza sativa with 45.4% of identity
• Blastx: Cytochrome P450 714C2 from Oryza sativa with 45.4% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (4351346)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451530.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;