| Transcript | Ll_transcript_509677 |
|---|---|
| CDS coordinates | 143-448 (+) |
| Peptide sequence | MVKEIFWSTIVLVICSVIILFQKLWLKPQRIRSMLQKQGISGPKPSFPFGNISEMLRIQHQPPESSNDLDKWVYSIFPYFHTWKQHYGIYIYIYAYIGVLN* |
| ORF Type | complete |
| Blastp | Cytochrome P450 714C2 from Oryza sativa with 48.28% of identity |
|---|---|
| Blastx | Cytochrome P450 714A1 from Arabidopsis with 51.58% of identity |
| Eggnog | Cytochrome p450(COG2124) |
| Kegg | Link to kegg annotations (4351346) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451530.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer