Protein coding transcript 50878

• Transcript: Ll_transcript_509693
• CDS coordinates: 198-1664 (+)
• Peptide sequence: MDSLISSIFLFLFTCTVIQILRSLSNKGNHNLPPGPSLLTILVNLNEFWKKPQQTMAKLANVYGPIMCLKVGHSTSVIISSPNMAKEVLQTHDLLFSDRTIPQVVTSLNHDLLSLAFLPVSPLWRDLRKICNNELFASKTLDASQDLRRQKLQQLLNDMHQISLSGEAVDVGIAAFKTCINFLSYTFVSEDFVQNGSKDDEYKDLVATLLKLTGTPNLVDLFPVFKIFDPQGLKRRTTSYLTKFFQILDNLINKRIKLREGKHYVTNNDMLDTLLNISEQNSQMMDKKKIRHFLLDLLVAGTDTTAYALERAMTELLHNPEIMTKAKKELEQTIGIGNPIEESDIARLPYLQAIIKETLRKYPPAPLLLPRKAKVDVQICGYTVPKGARVLINEWAIGRNPSFWENANSFLPERFIGSTIDVKGQNFQLTPFGSGRRICPGSPLAIRMLHSMLGSLINTFDWKLENNMNPKDMNLDQPLRAIPIKIND*
• ORF Type: complete

Annotations of Ll_transcript_509693

• Blastp: Geraniol 8-hydroxylase from Catharanthus with 46.56% of identity
• Blastx: Geraniol 8-hydroxylase from Catharanthus with 46.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAC80883)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428971.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;