Protein coding transcript 50895

• Transcript: Ll_transcript_509703
• CDS coordinates: 656-1348 (+)
• Peptide sequence: MMACERAGTVRRLIYTASVVSASPFKDHQSGFNDFMDETSWTPLNDSFAYLFLDHYHKDYVYSKTLAEKYILSYRKNENGEGLEVVTLPCGLVGGDTLQSFTPGSVGVLISQVTHNENAFKSLQFLENLLGKIPLVHVDDVCEAHIFCIENDSISGRYLCASSFISSKDIEDYYALHYPEFNVKQGNVDVVKKDIKWTSTKLCDKGFVYKYDTKMILDDSIKCARRVGDI*
• ORF Type: complete

Annotations of Ll_transcript_509703

• Blastp: Anthocyanidin reductase ((2S)-flavan-3-ol-forming) from Vitis with 31.86% of identity
• Blastx: Anthocyanidin reductase ((2S)-flavan-3-ol-forming) from Vitis with 32.66% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (100232981)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419141.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;